PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma477g00060.1
Common NameZOSMA_477G00060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family NF-YA
Protein Properties Length: 233aa    MW: 25483.8 Da    PI: 8.9928
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma477g00060.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1063.2e-3387143158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       dep+YVNaKQy++Il+RRq Rakle+++kl +k+rkpylheSRh hA++R RgsgGrF
  Zosma477g00060.1  87 DEPIYVNAKQYNAILRRRQVRAKLEAQQKL-IKGRKPYLHESRHLHAMKRVRGSGGRF 143
                       79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-3785146IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.40786146IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.2E-2888143IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-2389111IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686091111IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.0E-23120143IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGAGHADSEG KRVIDGHHHQ GNSEILYPTQ KFDYSQSITC FPYPYADPYL GGLVTAYGPP  60
TIMHPQMMGN VAAHSTRVPL PTEVTEDEPI YVNAKQYNAI LRRRQVRAKL EAQQKLIKGR  120
KPYLHESRHL HAMKRVRGSG GRFLNTKQLQ QSASSAAPSE ISKLSHPAML QLGGGWSVSE  180
ADALQSENGN AIASSLSSSE VTSISNCGDM MQMADVVRFS DLRPPVMSDH RL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2187148263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261977.13e-67PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
RefseqXP_010936981.12e-66PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_010936983.12e-66PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLA0A0K9P2251e-174A0A0K9P225_Z
STRINGGSMUA_Achr8P16700_0013e-55(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.49e-43nuclear factor Y, subunit A8